toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: White flag (medium) by Enrico Bertuccioli tagged popefrancis,pope,vatican,war,ukraine,russia,putin,zelensky,whiteflag,retreat,peace,negotiations,political,politicalcartoon,editorialcartoon,popefrancis,pope,vatican,war,ukraine,russia,putin,zelensky,whiteflag,retreat,peace,negotiations,political,politicalcartoon,editorialcartoon

White flag

#440023 / aantal keren
Enrico Bertuccioli van Enrico Bertuccioli
op March 11, 2024
rating-star 4
Applause
favorite
Favoriet
report spam
Melden

The words of Pope Francis leave their mark...
https://www.theguardian.com/world/2024/mar/10/pope-francis-criticised-f…

Politics »  National/Domestic  International  Elections  Terrorism  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Jobs & Social  Immigration  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Democracy  Energy

popefrancispopevaticanwarukrainerussiaputinzelenskywhiteflagretreatpeacenegotiationspoliticalpoliticalcartooneditorialcartoonpopefrancispopevaticanwarukrainerussiaputinzelenskywhiteflagretreatpeacenegotiationspoliticalpoliticalcartooneditorialcartoon

Collections

(1)
Political Cartoons - International!

Opmerkingen. (4)

 
Enrico Bertuccioli
Member
Erl wrote:
Great!

Many thanks Erl.

Enrico Bertuccioli, op March 11, 2024  report post  antwoorden applause 0

 
Erl
Member
Great!

Erl, op March 11, 2024  report post  antwoorden applause 0

 
Enrico Bertuccioli
Member
Shahid Atiq wrote:
Very good!

Thank you Shahid.

Enrico Bertuccioli, op March 11, 2024  report post  antwoorden applause 0

 
Shahid Atiq
Member
Very good!

Shahid Atiq, op March 11, 2024  report post  antwoorden applause 0

 
 

Opmerkingen toevoegen.
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar Enrico Bertuccioli


Cartoon: EU energy shortage (small) by Enrico Bertuccioli tagged eu,europe,energycrisis,energy,crises,government,war,political,power,control,electricity,bill,speculation,shortage,market,russia,ukraine,consumption,economy,business,renewableenergy
EU energy shortage
Cartoon: The claw of big tech (small) by Enrico Bertuccioli tagged world,newworldorder,technology,bigtech,technologicaldomain,domain,data,bigdata,power,control,neocapitalism,capitalism,technologicalcapitalism,digital,digitalcapitalism,money,business,economy,greed,dictatorship,political,politicalcartoon,editorialcartoon
The claw of big tech
Cartoon: Chinese real estate crisis (small) by Enrico Bertuccioli tagged china,chinese,realestate,realestatecrisis,chineserealestatecrisis,economy,money,finance,financialcrisis,debt,growth,markets,business,chinesegovernment,fallout,riskybusiness,consumers,consumerism,property,propertymarket,developement,economicdevelopement,exploitation,capitalism,political,politicalcartoon,editorialcartoon
Chinese real estate crisis
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.