toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: Warren Buffet and his Oscar (medium) by BinaryOptions tagged warren,buffet,optionsclick,oscar,best,actor,caricature,comic,webcomic,news,finances,market,trader,investor,trading,investing

Warren Buffet and his Oscar

#193862 / aantal keren
BinaryOptions van BinaryOptions
op February 26, 2013
rating-star 0
Applause
favorite
Favoriet
report spam
Melden

Editorial Warren Buffet caricature satirizing him as the Oscar winner for Best Market Actor, as distributed through the OptionsClick binary options news of February 25, 2013

Business »  Managers  Career  Stock Market  Money & Credits  Communication

warrenbuffetoptionsclickoscarbestactorcaricaturecomicwebcomicnewsfinancesmarkettraderinvestortradinginvesting

Opmerkingen. (1)

 
BinaryOptions
Member
Read the rest of the binary options news of February 25, 2013

BinaryOptions, op February 26, 2013  report post  antwoorden applause 0

 
 

Opmerkingen toevoegen.

Meer van deze kunstenaar BinaryOptions


Cartoon: Packaged Dolphin Meat Caricature (small) by BinaryOptions tagged tuna,dolphin,dolph,kist,canned,fish,mammal,sea,protein,meat,food,binary,option,options,trade,trading,optionsclick,editorial,cartoon,caricature,financial,business,news
Packaged Dolphin Meat Caricature
Cartoon: Reinhart Rogoff apologetic comic (small) by BinaryOptions tagged reinhart,rogoff,economists,economics,theory,mistake,fail,binary,option,options,trade,trading,optionsclick,editorial,cartoon,caricature,financial,economic,business,news,economy
Reinhart Rogoff apologetic comic
Cartoon: Case-Shiller housing price index (small) by BinaryOptions tagged financial,currency,forex,binary,options,option,trader,trade,trading,usd,bucky,dollar,case,shiller,home,price,index,editorial,news,cartoon,webcomic,optionsclick,comic,caricature,satire,recovery,economics,economy
Case-Shiller housing price index
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.