toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: Wahlkampfmannschaft (medium) by RABE tagged groko,union,cdu,csu,spd,merkel,akk,berlin,bundesregierung,befragung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,prügelei,halbzeit,halbzeitbilanz,friedrich,merz,söder,wahlkampf,wahlkampfmannschaft,guttenberg,wahlkampfkandidat,bundestagswahl,verjüngung,kabinett,hund,leine,groko,union,cdu,csu,spd,merkel,akk,berlin,bundesregierung,befragung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,prügelei,halbzeit,halbzeitbilanz,friedrich,merz,söder,wahlkampf,wahlkampfmannschaft,guttenberg,wahlkampfkandidat,bundestagswahl,verjüngung,kabinett,hund,leine

Wahlkampfmannschaft

#350730 / aantal keren
RABE van RABE
op January 17, 2020
rating-star 4
Applause
favorite
Favoriet
report spam
Melden

Ohne Worte

Politics »  National/Domestic  International  Elections  Military & Security  Taxes  Third World  Terrorism  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Immigration  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy  Energy

grokounioncducsuspdmerkelakkberlinbundesregierungbefragungraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoonprügeleihalbzeithalbzeitbilanzfriedrichmerzsöderwahlkampfwahlkampfmannschaftguttenbergwahlkampfkandidatbundestagswahlverjüngungkabinetthundleinegrokounioncducsuspdmerkelakkberlinbundesregierungbefragungraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoonprügeleihalbzeithalbzeitbilanzfriedrichmerzsöderwahlkampfwahlkampfmannschaftguttenbergwahlkampfkandidatbundestagswahlverjüngungkabinetthundleine

Opmerkingen. (3)

 
Erl
Member
Hund´ san´s scho!

Erl, op January 17, 2020  report post  antwoorden applause 0

 
Harm Bengen
Member
schwarzes zugpferd.

Harm Bengen, op January 17, 2020  report post  antwoorden applause 0

 
marian kamensky
Member
Hunderennen im Merz!!

marian kamensky, op January 17, 2020  report post  antwoorden applause 0

 
 

Opmerkingen toevoegen.
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar RABE


Cartoon: Gefahrenlage (small) by RABE tagged ampel,ampelregierung,rot,grün,gelb,fdp,spd,grüne,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,inflation,einkommen,rente,rentenpaket,bruch,streit,neuwahlen,wahlkampf,wahlversprechen,wahlversprechungen,wähler,michel,winter,schnee,lawine,skifahrer
Gefahrenlage
Cartoon: Armlängen voraus (small) by RABE tagged ampelregierung,scholz,spd,grüne,fdp,lindner,kinder,kindergrundsicherung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,bürger,gelder,steuern,abgaben,arme,armlänge,taschen,taschendieb
Armlängen voraus
Cartoon: Kochsalz für alle (small) by RABE tagged ampel,ampelregierung,rot,grün,gelb,fdp,spd,grüne,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,inflation,einkommen,rente,rentenpaket,bruch,streit,neuwahlen,karl,lauterbach,kochsalz,kochsalzlösung,engpass,nobelpreis,chemie,schweden,akademie,stockholm,protein
Kochsalz für alle
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data ( e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

Necessary Cookies: These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
Personalisation Cookies: These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
Convenience Cookies: These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
Analysis Cookies: These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.