toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: USA-Theater (medium) by Mirco Tomicek tagged donald,trump,joe,biden,tv,debatte,show,treffen,kandidaten,usa,us,amerika,präsident,president,präsidentschaftswahl,wahl,wahlkampf,kandidatur,election,2020,wahlen,america,puppentheater,theater,television,diskutieren,diskussionen,cartoon,karikatur,mirco,tomicek,donald,trump,joe,biden,tv,debatte,show,treffen,kandidaten,usa,us,amerika,präsident,president,präsidentschaftswahl,wahl,wahlkampf,kandidatur,election,2020,wahlen,america,puppentheater,theater,television,diskutieren,diskussionen,cartoon,karikatur,mirco,tomicek

USA-Theater

#367958 / aantal keren
Mirco Tomicek van Mirco Tomicek
op September 29, 2020
rating-star 1
Applause
favorite
Favoriet
report spam
Melden

Trump und Biden treffen in erster TV-Debatte aufeinander.
Vor dem ersten Treffen stellte Donald Trump seinen Gegenkandidaten Joe Biden als schwach und nicht besonders intelligent dar.

Politics »  National/Domestic  International  Elections  Taxes  Finances  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Jobs & Social  Fraud & Corruption  Historical  Other  Politicians  Parties  Privacy & Customer  Democracy  Energy

donaldtrumpjoebidentvdebatteshowtreffenkandidatenusausamerikapräsidentpresidentpräsidentschaftswahlwahlwahlkampfkandidaturelection2020wahlenamericapuppentheatertheatertelevisiondiskutierendiskussionencartoonkarikaturmircotomicekdonaldtrumpjoebidentvdebatteshowtreffenkandidatenusausamerikapräsidentpresidentpräsidentschaftswahlwahlwahlkampfkandidaturelection2020wahlenamericapuppentheatertheatertelevisiondiskutierendiskussionencartoonkarikaturmircotomicek

Opmerkingen. (0)

Opmerkingen toevoegen.  
 

Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar Mirco Tomicek


Cartoon: Fit For Ostern (small) by Mirco Tomicek tagged ostern,ostereiersuche,eiersuche,eier,ostereier,suche,osterhase,hase,eiweißpulver,eiweiß,protein,fit,fitness,sport,gym,kraftsport,training,whey,proteine,cartoon,karikatur,pressekarikatur,mirco,tomicek
Fit For Ostern
Cartoon: Fix it Joe (small) by Mirco Tomicek tagged joe,biden,wahl,wahlsieger,wahlsieg,kongress,bestätigt,sturm,us,usa,kapitol,capitol,amerika,washington,donald,trump,präsident,präsidenschaftswahl,president,wahlen,freiheit,proud,boys,liberty,stürmung,anhänger,mitläufer,polizei,demonstration,cartoon,karikatur,pressekarikatur,mirco,tomicek
Fix it Joe
Cartoon: Wegweisendes Urteil für VW (small) by Mirco Tomicek tagged vw,bgh,gericht,schadenersatz,schadensersatz,urteil,volkswagen,bundesgerichtshof,richter
Wegweisendes Urteil für VW
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.