toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: Strasse von Hormus (medium) by leopold maurer tagged hormus,trump,krieg,meerenge,schiffe,wirtschaft,welt,öl,ölpreis,finanzmärkte,entern,blockieren,minen,marine,nahost,iran,israel,usa,strasse,blockade,leopold,maurer,karikatur,cartoon,hormus,trump,krieg,meerenge,schiffe,wirtschaft,welt,öl,ölpreis,finanzmärkte,entern,blockieren,minen,marine,nahost,iran,israel,usa,strasse,blockade,leopold,maurer,karikatur,cartoon

Strasse von Hormus

#482700 / aantal keren
leopold maurer van leopold maurer
voor
rating-star 7
Applause
favorite
Favoriet
report spam
Melden

---

Politics »  National/Domestic  International

hormustrumpkriegmeerengeschiffewirtschaftweltölölpreisfinanzmärkteenternblockierenminenmarinenahostiranisraelusastrasseblockadeleopoldmaurerkarikaturcartoonhormustrumpkriegmeerengeschiffewirtschaftweltölölpreisfinanzmärkteenternblockierenminenmarinenahostiranisraelusastrasseblockadeleopoldmaurerkarikaturcartoon

Opmerkingen. (4)

 
Harm Bengen
Member
super!

Harm Bengen, voor  report post  antwoorden applause 0

 
Enrico Bertuccioli
Member
OUCH!

Enrico Bertuccioli, voor  report post  antwoorden applause 0

 
Erl
Member
Guten Rutsch möchte man da nicht wünschen ...

Erl, voor  report post  antwoorden applause 0

 
MorituruS
Member
Too much Rutsch!

MorituruS, voor  report post  antwoorden applause 0

 
 

Opmerkingen toevoegen.
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar leopold maurer


Cartoon: Omikron (small) by leopold maurer tagged virus,pandemie,corona,covid,sars,19,mutation,omikron,delta,ansteckend,schnell,protein,spike,rotkäppchen,impfung
Omikron
Cartoon: insight auf mars (small) by leopold maurer tagged insight,nasa,mars,landung,roboter,sonde,bohrer,maulwurf,loch,marsmensch,rover
insight auf mars
Cartoon: unterm teppich (small) by leopold maurer tagged deutschland,rechtsextrem,reichsbürger,kukluxklan
unterm teppich

  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon

  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies

  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren

  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.