toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: Putin Live (medium) by Mirco Tomicek tagged wladimir,putin,jahres,pressekonferenz,konferenz,presse,video,online,web,videochat,virtuell,fragestunde,stream,live,russland,moskau,nawalny,giftattacke,gift,kreml,attacke,corona,impfung,impfungen,covid19,impfe,russischer,präsident,pferd,reiten,reitet,digital,computer,medien,medienbericht,berichte,frage,antwort,fragen,cartoon,karikatur,pressekarikatur,mirco,tomicek,wladimir,putin,jahres,pressekonferenz,konferenz,presse,video,online,web,videochat,virtuell,fragestunde,stream,live,russland,moskau,nawalny,giftattacke,gift,kreml,attacke,corona,impfung,impfungen,covid19,impfe,russischer,präsident,pferd,reiten,reitet,digital,computer,medien,medienbericht,berichte,frage,antwort,fragen,cartoon,karikatur,pressekarikatur,mirco,tomicek

Putin Live

#373306 / aantal keren
Mirco Tomicek van Mirco Tomicek
op December 17, 2020
rating-star 2
Applause
favorite
Favoriet
report spam
Melden

Putin hält seine Jahres-Pressekonferenz erstmals per Video.

Politics »  National/Domestic  International  Elections  Military & Security  Taxes  Finances  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Privacy & Customer  Democracy  Energy

wladimirputinjahrespressekonferenzkonferenzpressevideoonlinewebvideochatvirtuellfragestundestreamliverusslandmoskaunawalnygiftattackegiftkremlattackecoronaimpfungimpfungencovid19impferussischerpräsidentpferdreitenreitetdigitalcomputermedienmedienberichtberichtefrageantwortfragencartoonkarikaturpressekarikaturmircotomicekwladimirputinjahrespressekonferenzkonferenzpressevideoonlinewebvideochatvirtuellfragestundestreamliverusslandmoskaunawalnygiftattackegiftkremlattackecoronaimpfungimpfungencovid19impferussischerpräsidentpferdreitenreitetdigitalcomputermedienmedienberichtberichtefrageantwortfragencartoonkarikaturpressekarikaturmircotomicek

Opmerkingen. (0)

Opmerkingen toevoegen.  
 

Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar Mirco Tomicek


Cartoon: Fit For Ostern (small) by Mirco Tomicek tagged ostern,ostereiersuche,eiersuche,eier,ostereier,suche,osterhase,hase,eiweißpulver,eiweiß,protein,fit,fitness,sport,gym,kraftsport,training,whey,proteine,cartoon,karikatur,pressekarikatur,mirco,tomicek
Fit For Ostern
Cartoon: Himmel und Hölle (small) by Mirco Tomicek tagged beherbergungsverbot,beherbergung,verbot,streit,länder,schutz,corona,covid19,virus,infektion,infizieren,ausbreitung,lockdown,maßnahmen,regeln,regel,angela,merkel,treffen,ministerpräsidenten,hotel,urlaub,kurzurlaub,motel,reise,reisen,ferien,herbstferien,vorkehrungen,verreisen,im,land,deutschland,risiko,risikogebiete,gebiete,karikatur,pressekarikatur,cartoon,mirco,tomicek
Himmel und Hölle
Cartoon: Erklärungsnot (small) by Mirco Tomicek tagged angela,merkel,regierungserklärung,erklärung,regierung,regiert,corona,covid19,virus,coronakrise,bundestag,pandemie,lockdown,shutdown,testen,tests,schnelltest,coronatest,getestet,impfen,impfungen,impfstoff,impfstrategie,osterruhe,ruhe,ostern,osterfeiertage,feiertage,entschuldigung,verzeihung,fund,italien,astrazeneca,impfstofffund,cartoon,karikatur,pressekarikatur,mirco,tomicek
Erklärungsnot
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.