toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: Pretty in Pink (medium) by KI-Vossy tagged us,defense,hegseth,pink,pete,navy,gay,milk,veteran,lgbtq,military,fleet,rename,vessel,ship,us,defense,hegseth,pink,pete,navy,gay,milk,veteran,lgbtq,military,fleet,rename,vessel,ship

Pretty in Pink

#465252 / aantal keren
KI-Vossy van KI-Vossy
op June 04, 2025
rating-star 5
Applause
favorite
Favoriet
report spam
Melden

The US defense secretary, Pete Hegseth, has ordered the US navy to strip the name of prominent gay rights activist and navy veteran Harvey Milk from a ship during the middle of June – a month meant to celebrate the LGBTQ+ community – according to multiple outlets. The decision to rename the ship will be publicized on 13 June.

But the new name has already been leaked ...

Politics »  Military & Security  Confederations  Historical  Other  Conflicts & War  Politicians  Parties  Democracy

usdefensehegsethpinkpetenavygaymilkveteranlgbtqmilitaryfleetrenamevesselshipusdefensehegsethpinkpetenavygaymilkveteranlgbtqmilitaryfleetrenamevesselship

Collections

(1)
U.S.A

Opmerkingen. (4)

 
ArtyFicial
Member
KI-Vossy wrote:
ArtyFicial wrote:
In 1959 Hollywood showed with a Blake Edwards comedy already how and why to use that unusually charming color: Operation Petticoat

:-)
That movie is fantastic. This reality is not.

ArtyFicial, op November 15, 2025  report post  antwoorden applause 0

 
KI-Vossy
Member
ArtyFicial wrote:
In 1959 Hollywood showed with a Blake Edwards comedy already how and why to use that unusually charming color: Operation Petticoat

:-)

KI-Vossy, op June 25, 2025  report post  antwoorden applause 1

 
ArtyFicial
Member
In 1959 Hollywood showed with a Blake Edwards comedy already how and why to use that unusually charming color: Operation Petticoat

ArtyFicial, op June 25, 2025  report post  antwoorden applause 0

 
Enrico Bertuccioli
Member
:-)

Enrico Bertuccioli, op June 04, 2025  report post  antwoorden applause 0

 
 

Opmerkingen toevoegen.
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar KI-Vossy


Cartoon: Unaussprechlich (small) by KI-Vossy tagged buchstaben,wales,ortsname,europa,urlaub,tld,domain,guiness,llanfair
Unaussprechlich
Cartoon: Wenn schon denn schon (small) by KI-Vossy tagged türkei,instagram,erdogan,sperre,netzwerk
Wenn schon denn schon
Cartoon: Flucht aus Teheran (small) by KI-Vossy tagged teheran,iran,krieg,flüchtlinge,mullahs,regime,spd,spione,teppich
Flucht aus Teheran
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.