toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: Nicht ohne! (medium) by KI-Vossy tagged cdu,csu,warken,spahn,fiege,maskendeal,maskenaffäre,covid,corona,maske,steuerzahler,bundestag,opposition,linke,grüne,haushaltsausschuss,gesundheitsministerium,cdu,csu,warken,spahn,fiege,maskendeal,maskenaffäre,covid,corona,maske,steuerzahler,bundestag,opposition,linke,grüne,haushaltsausschuss,gesundheitsministerium

Nicht ohne!

#466323 / aantal keren
KI-Vossy van KI-Vossy
op June 26, 2025
rating-star 2
Applause
favorite
Favoriet
report spam
Melden

Die Opposition setzt den Ex-Gesundheitsminister und heute Unionsfraktionschef Jens Spahn im Maskenstreit unter Druck. Die Linke fordert seinen Rücktritt, die Grünen mehr Aufklärung. Im Haushaltsauschuss standen Spahns Nachfolgerin als Gesundheitsministerin, Nina Warken, und Spahn selbst (beide CDU) Rede und Antwort.

Ein Drama für den Steuerzahler in Milliardenhöhe.

Politics »  National/Domestic  Elections  Taxes  Finances  Economy & Money  Family & Youth  Confederations  Jobs & Social  Fraud & Corruption  Other  Politicians  Parties  Democracy

cducsuwarkenspahnfiegemaskendealmaskenaffärecovidcoronamaskesteuerzahlerbundestagoppositionlinkegrünehaushaltsausschussgesundheitsministeriumcducsuwarkenspahnfiegemaskendealmaskenaffärecovidcoronamaskesteuerzahlerbundestagoppositionlinkegrünehaushaltsausschussgesundheitsministerium

Opmerkingen. (1)

 
Guest Avatar
Deleted
Somit bleibt die Torte wenigstens nicht in seinem Gesicht kleben.

, op June 26, 2025  report post  antwoorden applause 0

 
 

Opmerkingen toevoegen.
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar KI-Vossy


Cartoon: Don the Decorator (small) by KI-Vossy tagged republikaner,hakenkreuz,taylor,flagge,usa,washington,trump,republicans,meeting,flag,us,swastika,motif,republican,cross,right,wing,politiker,weiße,haus,decoration,decorations,decorator,paint,brown,potus
Don the Decorator
Cartoon: Private Shutdown (small) by KI-Vossy tagged usa,trump,melania,shutdown,haushaltssperre,washington,white,house,flotus,potus
Private Shutdown
Cartoon: Beaver hunt (small) by KI-Vossy tagged beaver,beavers,biber,britain,norfolk,england,wildlife,camera,kamera,pensthorpe,rodent,trunks,lodge,nigel,farage,vermin
Beaver hunt
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.