toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲

Welcome to toonpool.com,


world's largest community for cartoons, caricatures and fun drawings.

Browse 413262 artworks, discover unique items.

rightleftCartoons » Nieuwste cartoons
Cartoon: Impftal (medium) by leopold maurer tagged impfgipfel,impfplan,merkel,bund,länder,impfung,corona,covid,treffen,mangel,impfgipfel,impfplan,merkel,bund,länder,impfung,corona,covid,treffen,mangel

Impftal

#376600 / aantal keren
leopold maurer van leopold maurer
op February 01, 2021
rating-star 5
Applause
favorite
Favoriet
report spam
Melden

...

Politics »  National/Domestic  International  Health

impfgipfelimpfplanmerkelbundländerimpfungcoronacovidtreffenmangelimpfgipfelimpfplanmerkelbundländerimpfungcoronacovidtreffenmangel

Opmerkingen. (7)

Opmerkingen toevoegen.  
markus-grolik
Member
Alternativlos...

markus-grolik, op February 02, 2021  report post  antwoorden applause 0

 
Guest Avatar
Deleted
...für all die Zombies da draußen, die geimpft werden wollen!

, op February 01, 2021  report post  antwoorden applause 0

 
zenundsenf
Member
die schaffen das!

zenundsenf, op February 01, 2021  report post  antwoorden applause 0

 
Erl
Member
:-)))))

Erl, op February 01, 2021  report post  antwoorden applause 0

 
RABE
Member
An Worten nie verlegen!*****

RABE, op February 01, 2021  report post  antwoorden applause 0

 
Harm Bengen
Member
"weniger ist mehr".

Harm Bengen, op February 01, 2021  report post  antwoorden applause 0

 
Barthold
Member
ein Gesicht das nach akuter Suizidgefahr aussieht

Barthold, op February 01, 2021  report post  antwoorden applause 0

 
 

Opmerkingen toevoegen.
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar leopold maurer


Cartoon: Republikanerinnen vs. Trump (small) by leopold maurer tagged usa,wahl,republikaner,frauen,elefant,trump,vance,kandidat,vizepraesidenschaft,praesidentschaft,kritik,eigene,reihen,un,botschafterin,nikki,haley,liz,cheney,sexismus,alleinstehend,kinderlos,cat,ladies,leopold,maurer,karikatur,cartoon
Republikanerinnen vs. Trump
Cartoon: europa beim fundamt (small) by leopold maurer tagged europa,eu,fundamt,grenzen,obergrenzen,asylsuchende,flüchtlinge,humanismus,werte,ideologie,schengen
europa beim fundamt
Cartoon: Rezession (small) by leopold maurer tagged habeck,ampel,regierung,minister,wirtschaft,rezession,konjunkturprognose,nobelpreis,protein,verleihung,traum,loesung,problem,leopold,maurer,karikatur,cartoon
Rezession
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.