toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: Impfpflicht (medium) by leopold maurer tagged impfung,corona,covid,cov,sars,19,virus,impfpflicht,impfverweigerer,welle,vierte,brechen,loesung,impfgegner,impfung,corona,covid,cov,sars,19,virus,impfpflicht,impfverweigerer,welle,vierte,brechen,loesung,impfgegner

Impfpflicht

#394816 / aantal keren
leopold maurer van leopold maurer
op November 16, 2021
rating-star 6
Applause
favorite
Favoriet
report spam
Melden

...

Politics »  National/Domestic  International  Health  Parties  Democracy

impfungcoronacovidcovsars19virusimpfpflichtimpfverweigererwelleviertebrechenloesungimpfgegnerimpfungcoronacovidcovsars19virusimpfpflichtimpfverweigererwelleviertebrechenloesungimpfgegner

Opmerkingen. (4)

 
Barthold
Member
Damokles lässt grüßen

Barthold, op November 16, 2021  report post  antwoorden applause 0

 
Harm Bengen
Member
nah am boss.

Harm Bengen, op November 16, 2021  report post  antwoorden applause 0

 
RABE
Member
Am Boss soll's nicht scheitern!*****

RABE, op November 16, 2021  report post  antwoorden applause 0

 
Erl
Member
Alles Gute kommt von oben!

Erl, op November 16, 2021  report post  antwoorden applause 0

 
 

Opmerkingen toevoegen.
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar leopold maurer


Cartoon: DeSantis Kandidatur (small) by leopold maurer tagged usa,trump,desantis,kandidatur,präsidentschaftswahl,2024,maga,schneewittchen,königin,spiegel,disney,florida,wokeness,anti,rechts,jünger,neuer,republikaner,ron,donald,cartoon,karikatur,leopold,maurer
DeSantis Kandidatur
Cartoon: Rezession (small) by leopold maurer tagged habeck,ampel,regierung,minister,wirtschaft,rezession,konjunkturprognose,nobelpreis,protein,verleihung,traum,loesung,problem,leopold,maurer,karikatur,cartoon
Rezession
Cartoon: freiheitsstatue verbarrikadiert (small) by leopold maurer tagged usa,wahl,trump,biden,freiheitsstatue
freiheitsstatue verbarrikadiert
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.