toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: Free Nicolas! (medium) by KI-Vossy tagged frankreich,paris,nicolas,sarkozy,haft,frei,gefängnis,knast,justiz,berufung,freiheit,gericht,carla,bruni,president,francais,liberte,decide,tribunal,france,prison,release,free,freedom,appeal,supervision,aux,champs,elysees,frankreich,paris,nicolas,sarkozy,haft,frei,gefängnis,knast,justiz,berufung,freiheit,gericht,carla,bruni,president,francais,liberte,decide,tribunal,france,prison,release,free,freedom,appeal,supervision

Free Nicolas!

#473756 / aantal keren
KI-Vossy van KI-Vossy
op November 10, 2025
rating-star 3
Applause
favorite
Favoriet
report spam
Melden

Nach drei Wochen Haft kommt Frankreichs früherer Präsident Nicolas Sarkozy wieder aus dem Gefängnis. Unter Justizaufsicht darf er den Ausgang eines Berufungsverfahrens in Freiheit abwarten, entschied ein Gericht in Paris. Wenn das kein Grund zu feiern ist?

Après trois semaines de détention, l'ancien président français Nicolas Sarkozy sort de prison. Sous contrôle judiciaire, il pourra attendre l'issue de la procédure d'appel en liberté, a décidé un tribunal de Paris. N'est-ce pas là une raison de se réjouir ?

After three weeks in prison, France's former president Nicolas Sarkozy is being released. A court in Paris has ruled that he may await the outcome of an appeal while under judicial supervision. If that's not a reason to celebrate ...

Politics »  National/Domestic  Elections  Finances  Confederations  Jobs & Social  Fraud & Corruption  Historical  Other  Politicians  Parties  Democracy

frankreichparisnicolassarkozyhaftfreigefängnisknastjustizberufungfreiheitgerichtcarlabrunipresidentfrancaislibertedecidetribunalfranceprisonreleasefreefreedomappealsupervisionauxchampselyseesfrankreichparisnicolassarkozyhaftfreigefängnisknastjustizberufungfreiheitgerichtcarlabrunipresidentfrancaislibertedecidetribunalfranceprisonreleasefreefreedomappealsupervision

Opmerkingen. (2)

 
Barthold
Member
Ende der Schnupper-Haft . . .

Barthold, op November 12, 2025  report post  antwoorden applause 0

 
Shahid Atiq
Member
Excellent*****!

Shahid Atiq, op November 11, 2025  report post  antwoorden applause 0

 
 

Opmerkingen toevoegen.
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar KI-Vossy


Cartoon: Hacked Tesla (small) by KI-Vossy tagged tesla,musk,trump,grok,usa,ai,chatbot,chatgpt,antisemitisch,antisemitic,hacked,ki,autonom,autonomes,fahren,autonomous,driving,car,cars,auto,autos,xai,vehicle,vehilces,potus
Hacked Tesla
Cartoon: Unaussprechlich (small) by KI-Vossy tagged buchstaben,wales,ortsname,europa,urlaub,tld,domain,guiness,llanfair
Unaussprechlich
Cartoon: Mail from Elon! (small) by KI-Vossy tagged trump,musk,mail,fbi,usa,email,elon,entlassung,president,government,usd,potus
Mail from Elon!
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.