toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: Cyberwar (medium) by Enrico Bertuccioli tagged cyber,war,cyberwar,government,political,global,world,big,data,power,control,hackers,web,internet,difital,technology,international,conflict,code,national,security,safety,society,corporations,information,networks,maedia,fake,news,defense,military,virus,disinformation,weapon,espionage,malware,democracy

Cyberwar

#367712 / aantal keren
Enrico Bertuccioli van Enrico Bertuccioli
op September 25, 2020
rating-star 1
Applause
favorite
Favoriet
report spam
Melden

Cyber tank.

Politics »  National/Domestic  International  Elections  Military & Security  Terrorism  Finances  Economy & Money  Technology  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy

cyberwarcyberwargovernmentpoliticalglobalworldbigdatapowercontrolhackerswebinternetdifitaltechnologyinternationalconflictcodenationalsecuritysafetysocietycorporationsinformationnetworksmaediafakenewsdefensemilitaryvirusdisinformationweaponespionagemalwaredemocracy

Opmerkingen. (0)

Opmerkingen toevoegen.  
 

Meer van deze kunstenaar Enrico Bertuccioli


Cartoon: The claw of big tech (small) by Enrico Bertuccioli tagged world,newworldorder,technology,bigtech,technologicaldomain,domain,data,bigdata,power,control,neocapitalism,capitalism,technologicalcapitalism,digital,digitalcapitalism,money,business,economy,greed,dictatorship,political,politicalcartoon,editorialcartoon
The claw of big tech
Cartoon: Corruption virus (small) by Enrico Bertuccioli tagged corruption,bribery,virus,viral,covid19,health,safety,money,business,society,economy,fraud,political,government,parties,relationship,agreement,finance,financial
Corruption virus
Cartoon: Opium of the people (small) by Enrico Bertuccioli tagged football,supporters,fanaticism,sport,economy,money,business,society,people,global,world,championship,addiction,betting,game
Opium of the people
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.