toonpool logo
  • Agent
  • Collecties
  • meer
    • Community
    • Leden
    • Pro Search
    • Help
  • Log In




    • Password lost?
  • Registreren
  • nederlands
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Nieuwste cartoons
Cartoon: Büstenmacher (medium) by KI-Vossy tagged putin,afd,weidel,chrupalla,spiegel,keil,kreml,russland,umgang,macht,machtkampf,wahl,wahlen,regierung,reisen,partei,kritik,tino,putin,afd,weidel,chrupallsa,spiegel,keil,kreml,russland,umgang,macht,machtkampf,wahl,wahlen,regierung,reisen,partei,kritik

Büstenmacher

#473998 / aantal keren
KI-Vossy van KI-Vossy
op November 15, 2025
rating-star 3
Applause
favorite
Favoriet
report spam
Melden

Spiegel-Online spekuliert, dass der russische Präsident Vladimir Putin einen Keil zwischen den AfD-Chefs Tino Chrupalla und Alice Elisabeth Weidel treibt. Die AfD streitet über den Umgang mit dem Kreml. Dahinter steht der Machtkampf zwischen den beiden Parteichefs und ihre Unterstützer bringen sich bereits in Stellung. In der AfD haben geplante Russland-Reisen von Parteimitgliedern für Diskussionen gesorgt.

Während von Parteichefin Weidel zuletzt deutliche Kritik kam, hat sich nun auch Co-Chef Chrupalla geäußert - und die Pläne verteidigt.

Dazu ein erklärender Blick in Putins Werkstatt …

Politics »  National/Domestic  International  Elections  Taxes  Finances  Economy & Money  Education  Historical  Other  Politicians  Parties  Democracy

putinafdweidelchrupallaspiegelkeilkremlrusslandumgangmachtmachtkampfwahlwahlenregierungreisenparteikritiktinoputinafdweidelchrupallsaspiegelkeilkremlrusslandumgangmachtmachtkampfwahlwahlenregierungreisenparteikritik

Collections

(1)
Political Cartoons - International!

Opmerkingen. (1)

 
Shahid Atiq
Member
Excellent!

Shahid Atiq, op November 16, 2025  report post  antwoorden applause 0

 
 

Opmerkingen toevoegen.
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Meer van deze kunstenaar KI-Vossy


Cartoon: Don the Decorator (small) by KI-Vossy tagged republikaner,hakenkreuz,taylor,flagge,usa,washington,trump,republicans,meeting,flag,us,swastika,motif,republican,cross,right,wing,politiker,weiße,haus,decoration,decorations,decorator,paint,brown,potus
Don the Decorator
Cartoon: Das zweite Bilderrätsel (small) by KI-Vossy tagged krieg,frieden,hoffnung,europa,friede,stadt,hauptstadt,kunst,krankheit,gulaschsuppe,war,peace,hope,europe,city,capital,art,illness,goulash,soup,diseases,disease,putin,trump,budapest,ukraine,russland,russian,ungarn,hungary,orban,buda,pest
Das zweite Bilderrätsel
Cartoon: Im SUV (small) by KI-Vossy tagged suv,auto,autos,elektroautos,elektromobilität,verbrenner,fossil,mercedes,porsche,daimler,neuzulassungen,neuzulassung,deutschland,ost,west,ladenhüter,esuv,hersteller,autohersteller
Im SUV
  • Service

  • ToonAgent
  • help
  • FAQ
  • Daily Toon
  • Over ons

  • Over ons
  • Contact
  • Gebruiksvoorwaarden
  • Privacybeleid
  • Manage cookies
  • Community

  • Community
  • Pro Search
  • Collecties
  • Registreren
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.